![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
![]() | Protein Sex hormone-binding globulin [49945] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries) |
![]() | Domain d1d2sa_: 1d2s A: [24221] complexed with ca, dht |
PDB Entry: 1d2s (more details), 1.55 Å
SCOPe Domain Sequences for d1d2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsghpi mrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc
Timeline for d1d2sa_: