SCOPe 2.05: Domain d2ja3e_: 2ja3 E:

Lineage for d2ja3e_ (2ja3 E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries)

8. Domain d2ja3e_: 2ja3 E: [242205]
   automated match to d2j9lc_
   complexed with adp

Details for d2ja3e_

PDB Entry: 2ja3, 3.05 Å

PDB Description: cytoplasmic domain of the human chloride transporter clc-5 in complex with adp

PDB Compounds: (E:) chloride channel protein 5

SCOPe Domain Sequences for d2ja3e_:

Sequence, based on SEQRES records:

>d2ja3e_ d.37.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr
rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme
ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanqdpdsilfneflev

Sequence, based on observed residues (ATOM records):

>d2ja3e_ d.37.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr
rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme
ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanfneflev

Timeline for d2ja3e_:

• d2ja3e_ first appeared in SCOPe 2.04
  
• d2ja3e_ is called d2ja3e1 in SCOPe 2.06
  
• d2ja3e_ appears in the current release, SCOPe 2.08, called d2ja3e1