Class b: All beta proteins [48724] (126 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins) |
Protein Congerin I [49942] (1 species) |
Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries) |
Domain d1c1la_: 1c1l A: [24219] complexed with gal, glc |
PDB Entry: 1c1l (more details), 1.5 Å
SCOP Domain Sequences for d1c1la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster)} gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf lslagdarltlvkle
Timeline for d1c1la_: