Lineage for d1c1la_ (1c1l A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226891Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 226898Protein Congerin I [49942] (1 species)
  7. 226899Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries)
  8. 226900Domain d1c1la_: 1c1l A: [24219]
    complexed with gal, glc

Details for d1c1la_

PDB Entry: 1c1l (more details), 1.5 Å

PDB Description: lactose-liganded congerin i

SCOP Domain Sequences for d1c1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster)}
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle

SCOP Domain Coordinates for d1c1la_:

Click to download the PDB-style file with coordinates for d1c1la_.
(The format of our PDB-style files is described here.)

Timeline for d1c1la_: