SCOP 1.61: Domain d1c1la_: 1c1l A:

Lineage for d1c1la_ (1c1l A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)

6. Protein Congerin I [49942] (1 species)

7. Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries)

8. Domain d1c1la_: 1c1l A: [24219]

Details for d1c1la_

PDB Entry: 1c1l, 1.5 Å

PDB Description: lactose-liganded congerin i

SCOP Domain Sequences for d1c1la_:

Sequence; same for both SEQRES and ATOM records:

>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster)}
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle

Timeline for d1c1la_:

• d1c1la_ first appeared (with stable ids) in SCOP 1.55
  
• d1c1la_ appears in SCOP 1.59
  
• d1c1la_ appears in SCOP 1.63
  
• d1c1la_ appears in the current release, SCOPe 2.08