Lineage for d1c1la_ (1c1l A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57872Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 57877Protein Congerin I [49942] (1 species)
  7. 57878Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries)
  8. 57879Domain d1c1la_: 1c1l A: [24219]

Details for d1c1la_

PDB Entry: 1c1l (more details), 1.5 Å

PDB Description: lactose-liganded congerin i

SCOP Domain Sequences for d1c1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster)}
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle

SCOP Domain Coordinates for d1c1la_:

Click to download the PDB-style file with coordinates for d1c1la_.
(The format of our PDB-style files is described here.)

Timeline for d1c1la_: