Lineage for d1c1la_ (1c1l A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins) Protein Congerin I [49942] (1 species) Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries) 
Domain d1c1la_: 1c1l A: [24219]
Details for d1c1la_
PDB Entry: 1c1l (more details), 1.5 Å
PDB Description: lactose-liganded congerin i
SCOP Domain Sequences for d1c1la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster)}
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle
SCOP Domain Coordinates for d1c1la_:
Click to download the PDB-style file with coordinates for d1c1la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c1la_:
- d1c1la_ appears in SCOP 1.57
- d1c1la_ appears in the current release, SCOPe 2.08
View in 3D