SCOPe 2.07: Domain d2j0ub2: 2j0u B:244-407

Lineage for d2j0ub2 (2j0u B:244-407)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d2j0ub2: 2j0u B:244-407 [242183]
   automated match to d4brwa2
   protein/DNA complex; protein/RNA complex

Details for d2j0ub2

PDB Entry: 2j0u, 3 Å

PDB Description: the crystal structure of eif4aiii-barentsz complex at 3.0 a resolution

PDB Compounds: (B:) ATP-dependent RNA helicase ddx48

SCOPe Domain Sequences for d2j0ub2:

Sequence, based on SEQRES records:

>d2j0ub2 c.37.1.0 (B:244-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanft
vssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyih
rigrsgrygrkgvavnfvknddirvlrdieqyystqidempmnv

Sequence, based on observed residues (ATOM records):

>d2j0ub2 c.37.1.0 (B:244-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmretvsq
keresimkefrsgasrvlistvpqvsliinydlpnnrelyihrigrsgrygrkgvavnfv
knddirvlrdieqyystqidempmnv

Timeline for d2j0ub2:

• d2j0ub2 first appeared in SCOPe 2.04
  
• d2j0ub2 appears in SCOPe 2.06
  
• d2j0ub2 appears in the current release, SCOPe 2.08