Class b: All beta proteins [48724] (165 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
Protein Galectin-3 CRD [49940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49941] (6 PDB entries) |
Domain d1a3ka_: 1a3k A: [24218] complexed with gal, nag |
PDB Entry: 1a3k (more details), 2.1 Å
SCOP Domain Sequences for d1a3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3ka_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} livpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk lgisgdidltsasytmi
Timeline for d1a3ka_: