![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins) |
![]() | Protein Galectin-3 CRD [49940] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49941] (1 PDB entry) |
![]() | Domain d1a3k__: 1a3k - [24218] complexed with gal, nag |
PDB Entry: 1a3k (more details), 2.1 Å
SCOP Domain Sequences for d1a3k__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3k__ b.29.1.3 (-) Galectin-3 CRD {Human (Homo sapiens)} livpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivc ntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisk lgisgdidltsasytmi
Timeline for d1a3k__: