Lineage for d2izsa_ (2izs A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (741 PDB entries)
  8. 2545312Domain d2izsa_: 2izs A: [242177]
    automated match to d2c47d_
    complexed with brq, cl, mg, pgo

Details for d2izsa_

PDB Entry: 2izs (more details), 1.95 Å

PDB Description: structure of casein kinase gamma 3 in complex with inhibitor
PDB Compounds: (A:) casein kinase I isoform gamma-3

SCOPe Domain Sequences for d2izsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykqlgs
gdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyvhs
knliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgtary
msinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpiev
lcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlptp

SCOPe Domain Coordinates for d2izsa_:

Click to download the PDB-style file with coordinates for d2izsa_.
(The format of our PDB-style files is described here.)

Timeline for d2izsa_: