SCOPe 2.08: Domain d2izsa_: 2izs A:

Lineage for d2izsa_ (2izs A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d2izsa_: 2izs A: [242177]
   automated match to d2c47d_
   complexed with brq, cl, mg, pgo

Details for d2izsa_

PDB Entry: 2izs, 1.95 Å

PDB Description: structure of casein kinase gamma 3 in complex with inhibitor

PDB Compounds: (A:) casein kinase I isoform gamma-3

SCOPe Domain Sequences for d2izsa_:

Sequence; same for both SEQRES and ATOM records:

>d2izsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykqlgs
gdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyvhs
knliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgtary
msinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpiev
lcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlptp

Timeline for d2izsa_:

• d2izsa_ first appeared in SCOPe 2.04
  
• d2izsa_ appears in SCOPe 2.07