Lineage for d2itha_ (2ith A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903517Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2903647Species Haloferax volcanii [TaxId:2246] [53604] (3 PDB entries)
  8. 2903650Domain d2itha_: 2ith A: [242175]
    automated match to d1vdrb_

Details for d2itha_

PDB Entry: 2ith (more details)

PDB Description: nmr structure of haloferax volcanii dhfr
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2itha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itha_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]}
melvsvaalaenrvigrdgelpwpsipadkkqyrsrvaddpvvlgrttfesmrddlpgsa
qivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsr
vpgeyegdtyypewdaaeweldaetdhegftlqewvrsassr

SCOPe Domain Coordinates for d2itha_:

Click to download the PDB-style file with coordinates for d2itha_.
(The format of our PDB-style files is described here.)

Timeline for d2itha_: