| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) ![]() share the common active site structure with the family II |
| Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
| Protein automated matches [190554] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [255243] (1 PDB entry) |
| Domain d2ipab_: 2ipa B: [242170] Other proteins in same PDB: d2ipaa_ automated match to d1jl3a_ |
PDB Entry: 2ipa (more details)
SCOPe Domain Sequences for d2ipab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipab_ c.44.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
menkiiyflstgnsarsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis
nqtsdiidsdilnnadlvvtlsgdaadkcpmtpphvkrehwgfddparaqgteeekwaff
qrvrdeignrlkefaetgk
Timeline for d2ipab_: