Lineage for d2ipab_ (2ipa B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874896Protein automated matches [190554] (2 species)
    not a true protein
  7. 2874897Species Bacillus subtilis [TaxId:1423] [255243] (1 PDB entry)
  8. 2874898Domain d2ipab_: 2ipa B: [242170]
    Other proteins in same PDB: d2ipaa_
    automated match to d1jl3a_

Details for d2ipab_

PDB Entry: 2ipa (more details)

PDB Description: solution structure of trx-arsc complex
PDB Compounds: (B:) protein arsc

SCOPe Domain Sequences for d2ipab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipab_ c.44.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
menkiiyflstgnsarsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis
nqtsdiidsdilnnadlvvtlsgdaadkcpmtpphvkrehwgfddparaqgteeekwaff
qrvrdeignrlkefaetgk

SCOPe Domain Coordinates for d2ipab_:

Click to download the PDB-style file with coordinates for d2ipab_.
(The format of our PDB-style files is described here.)

Timeline for d2ipab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ipaa_