Lineage for d1qkqa_ (1qkq A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460265Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 460266Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)
  7. 460267Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries)
  8. 460271Domain d1qkqa_: 1qkq A: [24217]

Details for d1qkqa_

PDB Entry: 1qkq (more details), 1.8 Å

PDB Description: charcot-leyden crystal protein - mannose complex

SCOP Domain Sequences for d1qkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkqa_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

SCOP Domain Coordinates for d1qkqa_:

Click to download the PDB-style file with coordinates for d1qkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qkqa_: