SCOP 1.69: Domain d1qkqa_: 1qkq A:

Lineage for d1qkqa_ (1qkq A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries)

8. Domain d1qkqa_: 1qkq A: [24217]

Details for d1qkqa_

PDB Entry: 1qkq, 1.8 Å

PDB Description: charcot-leyden crystal protein - mannose complex

SCOP Domain Sequences for d1qkqa_:

Sequence; same for both SEQRES and ATOM records:

>d1qkqa_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

Timeline for d1qkqa_:

• d1qkqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qkqa_ appears in SCOP 1.67
  
• d1qkqa_ appears in SCOP 1.71
  
• d1qkqa_ appears in the current release, SCOPe 2.08