Lineage for d1qkqa_ (1qkq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779191Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)
  7. 2779192Species Human (Homo sapiens) [TaxId:9606] [49939] (5 PDB entries)
  8. 2779195Domain d1qkqa_: 1qkq A: [24217]
    complexed with man

Details for d1qkqa_

PDB Entry: 1qkq (more details), 1.8 Å

PDB Description: charcot-leyden crystal protein - mannose complex
PDB Compounds: (A:) eosinophil lysophospholipase

SCOPe Domain Sequences for d1qkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkqa_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

SCOPe Domain Coordinates for d1qkqa_:

Click to download the PDB-style file with coordinates for d1qkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qkqa_: