| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49939] (5 PDB entries) |
| Domain d1qkqa_: 1qkq A: [24217] complexed with man |
PDB Entry: 1qkq (more details), 1.8 Å
SCOPe Domain Sequences for d1qkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkqa_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr
Timeline for d1qkqa_: