| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein automated matches [190442] (14 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [255197] (3 PDB entries) |
| Domain d2ipaa_: 2ipa A: [242169] Other proteins in same PDB: d2ipab_ automated match to d3diea_ |
PDB Entry: 2ipa (more details)
SCOPe Domain Sequences for d2ipaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipaa_ c.47.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvden
qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl
Timeline for d2ipaa_: