Lineage for d2ipaa_ (2ipa A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484376Protein automated matches [190442] (14 species)
    not a true protein
  7. 2484383Species Bacillus subtilis [TaxId:1423] [255197] (3 PDB entries)
  8. 2484386Domain d2ipaa_: 2ipa A: [242169]
    Other proteins in same PDB: d2ipab_
    automated match to d3diea_

Details for d2ipaa_

PDB Entry: 2ipa (more details)

PDB Description: solution structure of trx-arsc complex
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2ipaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipaa_ c.47.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvden
qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl

SCOPe Domain Coordinates for d2ipaa_:

Click to download the PDB-style file with coordinates for d2ipaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ipaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ipab_