SCOPe 2.08: Domain d2ipaa_: 2ipa A:

Lineage for d2ipaa_ (2ipa A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255197] (3 PDB entries)

8. Domain d2ipaa_: 2ipa A: [242169]
   Other proteins in same PDB: d2ipab_
   automated match to d3diea_

Details for d2ipaa_

PDB Entry: 2ipa

PDB Description: solution structure of trx-arsc complex

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2ipaa_:

Sequence; same for both SEQRES and ATOM records:

>d2ipaa_ c.47.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvden
qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl

Timeline for d2ipaa_:

• d2ipaa_ first appeared in SCOPe 2.04
  
• d2ipaa_ appears in SCOPe 2.07