SCOPe 2.07: Domain d1lcla_: 1lcl A:

Lineage for d1lcla_ (1lcl A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49939] (5 PDB entries)

8. Domain d1lcla_: 1lcl A: [24216]

Details for d1lcla_

PDB Entry: 1lcl, 1.8 Å

PDB Description: charcot-leyden crystal protein

PDB Compounds: (A:) lysophospholipase

SCOPe Domain Sequences for d1lcla_:

Sequence; same for both SEQRES and ATOM records:

>d1lcla_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

Timeline for d1lcla_:

• d1lcla_ first appeared (with stable ids) in SCOP 1.55, called d1lcl__
  
• d1lcla_ appears in SCOPe 2.06
  
• d1lcla_ appears in the current release, SCOPe 2.08