SCOP 1.69: Domain d1lcl__: 1lcl -

Lineage for d1lcl__ (1lcl -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries)

8. Domain d1lcl__: 1lcl - [24216]

Details for d1lcl__

PDB Entry: 1lcl, 1.8 Å

PDB Description: charcot-leyden crystal protein

SCOP Domain Sequences for d1lcl__:

Sequence; same for both SEQRES and ATOM records:

>d1lcl__ b.29.1.3 (-) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

Timeline for d1lcl__:

• d1lcl__ first appeared (with stable ids) in SCOP 1.55
  
• d1lcl__ appears in SCOP 1.67
  
• d1lcl__ appears in SCOP 1.71
  
• d1lcl__ appears in the current release, SCOPe 2.08, called d1lcla_