Lineage for d1lcl__ (1lcl -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226891Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 226892Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species)
  7. 226893Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries)
  8. 226896Domain d1lcl__: 1lcl - [24216]

Details for d1lcl__

PDB Entry: 1lcl (more details), 1.8 Å

PDB Description: charcot-leyden crystal protein

SCOP Domain Sequences for d1lcl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcl__ b.29.1.3 (-) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

SCOP Domain Coordinates for d1lcl__:

Click to download the PDB-style file with coordinates for d1lcl__.
(The format of our PDB-style files is described here.)

Timeline for d1lcl__: