Lineage for d1lcl__ (1lcl -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins) 
Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49939] (2 PDB entries) 
Domain d1lcl__: 1lcl - [24216]
Details for d1lcl__
PDB Entry: 1lcl (more details), 1.8 Å
PDB Description: charcot-leyden crystal protein
SCOP Domain Sequences for d1lcl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lcl__ b.29.1.3 (-) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr
SCOP Domain Coordinates for d1lcl__:
Click to download the PDB-style file with coordinates for d1lcl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lcl__:
- d1lcl__ first appeared (with stable ids) in SCOP 1.55
- d1lcl__ appears in SCOP 1.59
- d1lcl__ appears in the current release, SCOPe 2.08, called d1lcla_
View in 3D