Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
Protein automated matches [190703] (6 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255239] (4 PDB entries) |
Domain d2ii5e_: 2ii5 E: [242157] automated match to d3maec_ complexed with act, cl, co6 |
PDB Entry: 2ii5 (more details), 2.5 Å
SCOPe Domain Sequences for d2ii5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ii5e_ c.43.1.0 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} gkdrtepvkgfhkamvktmsaalkiphfgycdevdltelvklreelkpiafargiklsfm pfflkaaslgllqfpilnasvdencqnitykashnigiamdteqglivpnvknvqirsif eiatelnrlqklgsagqlstndliggtftlsnigsiggtyakpvilppevaigalgtika lprfnekgevckaqimnvswsadhriidgatvsrfsnlwksylenpafmlldlk
Timeline for d2ii5e_: