| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) ![]() |
| Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
| Protein automated matches [190703] (5 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [255239] (4 PDB entries) |
| Domain d2ii5b_: 2ii5 B: [242154] automated match to d3maec_ complexed with act, cl, co6 |
PDB Entry: 2ii5 (more details), 2.5 Å
SCOPe Domain Sequences for d2ii5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ii5b_ c.43.1.0 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gkdrtepvkgfhkamvktmsaalkiphfgycdevdltelvklreelkpiafargiklsfm
pfflkaaslgllqfpilnasvdencqnitykashnigiamdteqglivpnvknvqirsif
eiatelnrlqklgsagqlstndliggtftlsnigsiggtyakpvilppevaigalgtika
lprfnekgevckaqimnvswsadhriidgatvsrfsnlwksylenpafmlldlk
Timeline for d2ii5b_: