Lineage for d2ii5a_ (2ii5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874761Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2874762Protein automated matches [190703] (7 species)
    not a true protein
  7. 2874767Species Cow (Bos taurus) [TaxId:9913] [255239] (4 PDB entries)
  8. 2874776Domain d2ii5a_: 2ii5 A: [242153]
    automated match to d3maec_
    complexed with act, cl, co6

Details for d2ii5a_

PDB Entry: 2ii5 (more details), 2.5 Å

PDB Description: crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), isobutyryl-coenzyme a-bound form
PDB Compounds: (A:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex

SCOPe Domain Sequences for d2ii5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ii5a_ c.43.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gkdrtepvkgfhkamvktmsaalkiphfgycdevdltelvklreelkpiafargiklsfm
pfflkaaslgllqfpilnasvdencqnitykashnigiamdteqglivpnvknvqirsif
eiatelnrlqklgsagqlstndliggtftlsnigsiggtyakpvilppevaigalgtika
lprfnekgevckaqimnvswsadhriidgatvsrfsnlwksylenpafmlldlk

SCOPe Domain Coordinates for d2ii5a_:

Click to download the PDB-style file with coordinates for d2ii5a_.
(The format of our PDB-style files is described here.)

Timeline for d2ii5a_: