SCOPe 2.08: Domain d1ganb_: 1gan B:

Lineage for d1ganb_ (1gan B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)

8. Domain d1ganb_: 1gan B: [24215]

Details for d1ganb_

PDB Entry: 1gan, 2.23 Å

PDB Description: complex of toad ovary galectin with n-acetylgalactose

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d1ganb_:

Sequence; same for both SEQRES and ATOM records:

>d1ganb_ b.29.1.3 (B:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
lsleglqfksitte

Timeline for d1ganb_:

• d1ganb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ganb_ appears in SCOPe 2.07