Lineage for d1ganb_ (1gan B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779208Protein Galectin-1 [100925] (5 species)
  7. 2779313Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)
  8. 2779317Domain d1ganb_: 1gan B: [24215]

Details for d1ganb_

PDB Entry: 1gan (more details), 2.23 Å

PDB Description: complex of toad ovary galectin with n-acetylgalactose
PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d1ganb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ganb_ b.29.1.3 (B:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
lsleglqfksitte

SCOPe Domain Coordinates for d1ganb_:

Click to download the PDB-style file with coordinates for d1ganb_.
(The format of our PDB-style files is described here.)

Timeline for d1ganb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gana_