Lineage for d2ii3f_ (2ii3 F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851362Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1851363Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1851531Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 1851532Protein automated matches [190703] (6 species)
    not a true protein
  7. 1851537Species Cow (Bos taurus) [TaxId:9913] [255239] (4 PDB entries)
  8. 1851543Domain d2ii3f_: 2ii3 F: [242142]
    automated match to d3maec_
    complexed with act, cao, cl

Details for d2ii3f_

PDB Entry: 2ii3 (more details), 2.17 Å

PDB Description: crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), oxidized coenzyme a-bound form
PDB Compounds: (F:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex

SCOPe Domain Sequences for d2ii3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ii3f_ c.43.1.0 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gkdrtepvkgfhkamvktmsaalkiphfgycdevdltelvklreelkpiafargiklsfm
pfflkaaslgllqfpilnasvdencqnitykashnigiamdteqglivpnvknvqirsif
eiatelnrlqklgsagqlstndliggtftlsnigsiggtyakpvilppevaigalgtika
lprfnekgevckaqimnvswsadhriidgatvsrfsnlwksylenpafmlldlk

SCOPe Domain Coordinates for d2ii3f_:

Click to download the PDB-style file with coordinates for d2ii3f_.
(The format of our PDB-style files is described here.)

Timeline for d2ii3f_: