![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
![]() | Protein Galectin-1 [100925] (4 species) |
![]() | Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries) |
![]() | Domain d1a78b_: 1a78 B: [24213] complexed with dtt, tdg |
PDB Entry: 1a78 (more details), 2 Å
SCOP Domain Sequences for d1a78b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a78b_ b.29.1.3 (B:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf lsleglafksitte
Timeline for d1a78b_: