SCOPe 2.08: Domain d1a78b_: 1a78 B:

Lineage for d1a78b_ (1a78 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)

8. Domain d1a78b_: 1a78 B: [24213]
   complexed with dtt

Details for d1a78b_

PDB Entry: 1a78, 2 Å

PDB Description: complex of toad ovary galectin with thio-digalactose

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d1a78b_:

Sequence; same for both SEQRES and ATOM records:

>d1a78b_ b.29.1.3 (B:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf
lsleglafksitte

Timeline for d1a78b_:

• d1a78b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a78b_ appears in SCOPe 2.07