![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.0: automated matches [227287] (1 protein) not a true family |
![]() | Protein automated matches [227105] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255238] (1 PDB entry) |
![]() | Domain d2ihmb3: 2ihm B:290-496 [242128] Other proteins in same PDB: d2ihma1, d2ihma2, d2ihmb1, d2ihmb2 automated match to d1jmsa4 protein/DNA complex; complexed with d3t, mg, na |
PDB Entry: 2ihm (more details), 2.4 Å
SCOPe Domain Sequences for d2ihmb3:
Sequence, based on SEQRES records: (download)
>d2ihmb3 d.218.1.0 (B:290-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vrradaealqqlieaavrqtlpgatvtltggfrrgklqghdvdflithpeegqevgllpk vmsclqsqglvlyhqyhrshladsahnlrqrsstmdvfersfcilglpqpqqaalagalp pcptwkavrvdlvvtpssqfpfallgwtgsqfferelrrfsrqekglwlnshglfdpeqk rvfhatseedvfrllglkylppeqrna
>d2ihmb3 d.218.1.0 (B:290-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vrradaealqqlieaavrqtlpgatvtltggfrrgklqghdvdflithpeegqevgllpk vmsclqsqglvlyhqyfersfcilglpqpqqagalppcptwkavrvdlvvtpssqfpfal lgwtgsqfferelrrfsrqekglwlnshglfdpeqkrvfhatseedvfrllglkylppeq rna
Timeline for d2ihmb3: