Lineage for d1a78a_ (1a78 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556305Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 556322Protein Galectin-1 [100925] (4 species)
  7. 556352Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)
  8. 556353Domain d1a78a_: 1a78 A: [24212]

Details for d1a78a_

PDB Entry: 1a78 (more details), 2 Å

PDB Description: complex of toad ovary galectin with thio-digalactose

SCOP Domain Sequences for d1a78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a78a_ b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum)}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf
lsleglafksitte

SCOP Domain Coordinates for d1a78a_:

Click to download the PDB-style file with coordinates for d1a78a_.
(The format of our PDB-style files is described here.)

Timeline for d1a78a_: