Lineage for d2ieya_ (2iey A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872531Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries)
  8. 2872572Domain d2ieya_: 2iey A: [242114]
    automated match to d3sfva_
    complexed with gdp

Details for d2ieya_

PDB Entry: 2iey (more details), 3.18 Å

PDB Description: Crystal Structure of mouse Rab27b bound to GDP in hexagonal space group
PDB Compounds: (A:) Ras-related protein Rab-27B

SCOPe Domain Sequences for d2ieya_:

Sequence, based on SEQRES records: (download)

>d2ieya_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgasg
kafkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanayc
enpdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimk
rm

Sequence, based on observed residues (ATOM records): (download)

>d2ieya_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydfkvhlqlwd
tslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignkadlpdqr
evnerqarelaekygipyfetsaatgqnveksvetlldlimkrm

SCOPe Domain Coordinates for d2ieya_:

Click to download the PDB-style file with coordinates for d2ieya_.
(The format of our PDB-style files is described here.)

Timeline for d2ieya_: