![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein Galectin-1 [100925] (5 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [49936] (1 PDB entry) galectin-1 homologue CG-16 |
![]() | Domain d1qmjb_: 1qmj B: [24211] complexed with bme |
PDB Entry: 1qmj (more details), 2.15 Å
SCOPe Domain Sequences for d1qmjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmjb_ b.29.1.3 (B:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav egdfkvkaikfs
Timeline for d1qmjb_: