Lineage for d1qmjb_ (1qmj B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050578Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2050595Protein Galectin-1 [100925] (5 species)
  7. 2050596Species Chicken (Gallus gallus) [TaxId:9031] [49936] (1 PDB entry)
    galectin-1 homologue CG-16
  8. 2050598Domain d1qmjb_: 1qmj B: [24211]
    complexed with bme

Details for d1qmjb_

PDB Entry: 1qmj (more details), 2.15 Å

PDB Description: cg-16, a homodimeric agglutinin from chicken liver
PDB Compounds: (B:) beta-galactoside-binding lectin

SCOPe Domain Sequences for d1qmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmjb_ b.29.1.3 (B:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]}
qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn
skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav
egdfkvkaikfs

SCOPe Domain Coordinates for d1qmjb_:

Click to download the PDB-style file with coordinates for d1qmjb_.
(The format of our PDB-style files is described here.)

Timeline for d1qmjb_: