Lineage for d1qmjb_ (1qmj B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556305Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 556322Protein Galectin-1 [100925] (4 species)
  7. 556323Species Chicken (Gallus gallus) [TaxId:9031] [49936] (1 PDB entry)
    galectin-1 homologue CG-16
  8. 556325Domain d1qmjb_: 1qmj B: [24211]

Details for d1qmjb_

PDB Entry: 1qmj (more details), 2.15 Å

PDB Description: cg-16, a homodimeric agglutinin from chicken liver

SCOP Domain Sequences for d1qmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmjb_ b.29.1.3 (B:) Galectin-1 {Chicken (Gallus gallus)}
qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn
skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav
egdfkvkaikfs

SCOP Domain Coordinates for d1qmjb_:

Click to download the PDB-style file with coordinates for d1qmjb_.
(The format of our PDB-style files is described here.)

Timeline for d1qmjb_: