SCOPe 2.08: Domain d2ib1a_: 2ib1 A:

Lineage for d2ib1a_ (2ib1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.0: automated matches [254238] (1 protein)
   not a true family

6. Protein automated matches [254542] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255234] (2 PDB entries)

8. Domain d2ib1a_: 2ib1 A: [242106]
   automated match to d4f44a_

Details for d2ib1a_

PDB Entry: 2ib1

PDB Description: solution structure of p45 death domain

PDB Compounds: (A:) Death domain containing membrane protein NRADD

SCOPe Domain Sequences for d2ib1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ib1a_ a.77.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pqqqqeevqrllmmgepakgwqelaghlgyqaeavetmacdqmpaytllrnwaaqegnra
tlrvledalaaigredvvqvlsspaesssvv

Timeline for d2ib1a_:

• d2ib1a_ first appeared in SCOPe 2.04
  
• d2ib1a_ appears in SCOPe 2.07