Lineage for d2ib1a_ (2ib1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719058Family a.77.1.0: automated matches [254238] (1 protein)
    not a true family
  6. 2719059Protein automated matches [254542] (3 species)
    not a true protein
  7. 2719072Species Mouse (Mus musculus) [TaxId:10090] [255234] (2 PDB entries)
  8. 2719074Domain d2ib1a_: 2ib1 A: [242106]
    automated match to d4f44a_

Details for d2ib1a_

PDB Entry: 2ib1 (more details)

PDB Description: solution structure of p45 death domain
PDB Compounds: (A:) Death domain containing membrane protein NRADD

SCOPe Domain Sequences for d2ib1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ib1a_ a.77.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pqqqqeevqrllmmgepakgwqelaghlgyqaeavetmacdqmpaytllrnwaaqegnra
tlrvledalaaigredvvqvlsspaesssvv

SCOPe Domain Coordinates for d2ib1a_:

Click to download the PDB-style file with coordinates for d2ib1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ib1a_: