Lineage for d2i9lg1 (2i9l G:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767177Domain d2i9lg1: 2i9l G:1-112 [242104]
    Other proteins in same PDB: d2i9la2, d2i9lc2, d2i9le2, d2i9lg2
    automated match to d3okla1
    complexed with gol

Details for d2i9lg1

PDB Entry: 2i9l (more details), 3.1 Å

PDB Description: structure of fab 7d11 from a neutralizing antibody against the poxvirus l1 protein
PDB Compounds: (G:) Antibody 7D11 light chain

SCOPe Domain Sequences for d2i9lg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9lg1 b.1.1.0 (G:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dmvmsqspsslavsagekvsmsckssqtllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlwtfgggtkleik

SCOPe Domain Coordinates for d2i9lg1:

Click to download the PDB-style file with coordinates for d2i9lg1.
(The format of our PDB-style files is described here.)

Timeline for d2i9lg1: