SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2i9le1 (2i9l E:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (24 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (514 PDB entries)
  8. 2029038Domain d2i9le1: 2i9l E:1-112 [242102]
    Other proteins in same PDB: d2i9la2, d2i9lc2, d2i9le2, d2i9lg2
    automated match to d3okla1
    complexed with gol

Details for d2i9le1

PDB Entry: 2i9l (more details), 3.1 Å

PDB Description: Structure of Fab 7D11 from a neutralizing antibody against the poxvirus L1 protein
PDB Compounds: (E:) Antibody 7D11 light chain

SCOPe Domain Sequences for d2i9le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9le1 b.1.1.0 (E:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dmvmsqspsslavsagekvsmsckssqtllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlwtfgggtkleik

SCOPe Domain Coordinates for d2i9le1:

Click to download the PDB-style file with coordinates for d2i9le1.
(The format of our PDB-style files is described here.)

Timeline for d2i9le1: