SCOPe 2.08: Domain d2i8na1: 2i8n A:1-106

Lineage for d2i8na1 (2i8n A:1-106)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d2i8na1: 2i8n A:1-106 [242096]
   Other proteins in same PDB: d2i8na2
   automated match to d1e6ia_

Details for d2i8na1

PDB Entry: 2i8n

PDB Description: solution structure of the second bromodomain of brd4

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d2i8na1:

Sequence; same for both SEQRES and ATOM records:

>d2i8na1 a.29.2.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskleare
yrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm

Timeline for d2i8na1:

• d2i8na1 first appeared in SCOPe 2.04, called d2i8na_
  
• d2i8na1 appears in SCOPe 2.07