Lineage for d2i8fa_ (2i8f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691380Species Pseudomonas stutzeri [TaxId:96564] [255233] (1 PDB entry)
  8. 2691381Domain d2i8fa_: 2i8f A: [242095]
    automated match to d1ccha_
    complexed with hec; mutant

Details for d2i8fa_

PDB Entry: 2i8f (more details)

PDB Description: solution conformation of the h47a mutant of pseudomonas stutzeri zobell ferrocytochrome c-551
PDB Compounds: (A:) cytochrome c-551

SCOPe Domain Sequences for d2i8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i8fa_ a.3.1.1 (A:) automated matches {Pseudomonas stutzeri [TaxId: 96564]}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalaikngsqgvwgpip
mppnpvteeeakilaewvlslk

SCOPe Domain Coordinates for d2i8fa_:

Click to download the PDB-style file with coordinates for d2i8fa_.
(The format of our PDB-style files is described here.)

Timeline for d2i8fa_: