![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein automated matches [190113] (17 species) not a true protein |
![]() | Species Pseudomonas stutzeri [TaxId:96564] [255233] (1 PDB entry) |
![]() | Domain d2i8fa_: 2i8f A: [242095] automated match to d1ccha_ complexed with hec; mutant |
PDB Entry: 2i8f (more details)
SCOPe Domain Sequences for d2i8fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i8fa_ a.3.1.1 (A:) automated matches {Pseudomonas stutzeri [TaxId: 96564]} qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalaikngsqgvwgpip mppnpvteeeakilaewvlslk
Timeline for d2i8fa_: