Lineage for d2i85a_ (2i85 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772145Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 2772167Protein automated matches [190316] (1 species)
    not a true protein
  7. 2772168Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries)
  8. 2772177Domain d2i85a_: 2i85 A: [242094]
    automated match to d3gxub_

Details for d2i85a_

PDB Entry: 2i85 (more details)

PDB Description: nmr solution structure of human ephrinb2 ectodomain
PDB Compounds: (A:) ephrin-b2

SCOPe Domain Sequences for d2i85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i85a_ b.6.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sksivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkd
qadrctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngsleg
ldnqeggvcqtramkilmkvgq

SCOPe Domain Coordinates for d2i85a_:

Click to download the PDB-style file with coordinates for d2i85a_.
(The format of our PDB-style files is described here.)

Timeline for d2i85a_: