| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) |
| Domain d2i7ka1: 2i7k A:1-108 [242093] Other proteins in same PDB: d2i7ka2, d2i7ka3 automated match to d4lc2a_ |
PDB Entry: 2i7k (more details)
SCOPe Domain Sequences for d2i7ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i7ka1 a.29.2.0 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeveqtplqealnqlmrqlqrkdpsaffsfpvtdfiapgysmiikhpmdfstmkekiknn
dyqsieelkdnfklmctnamiynkpetiyykaakkllhsgmkilsqer
Timeline for d2i7ka1: