SCOPe 2.08: Domain d2i7ka1: 2i7k A:1-108

Lineage for d2i7ka1 (2i7k A:1-108)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d2i7ka1: 2i7k A:1-108 [242093]
   Other proteins in same PDB: d2i7ka2, d2i7ka3
   automated match to d4lc2a_

Details for d2i7ka1

PDB Entry: 2i7k

PDB Description: solution structure of the bromodomain of human brd7 protein

PDB Compounds: (A:) Bromodomain-containing protein 7

SCOPe Domain Sequences for d2i7ka1:

Sequence; same for both SEQRES and ATOM records:

>d2i7ka1 a.29.2.0 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeveqtplqealnqlmrqlqrkdpsaffsfpvtdfiapgysmiikhpmdfstmkekiknn
dyqsieelkdnfklmctnamiynkpetiyykaakkllhsgmkilsqer

Timeline for d2i7ka1:

• d2i7ka1 first appeared in SCOPe 2.04, called d2i7ka_
  
• d2i7ka1 appears in SCOPe 2.07