![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins) |
![]() | Protein S-lectin, different isoforms [49933] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries) |
![]() | Domain d1hlcb_: 1hlc B: [24209] complexed with gal, glc |
PDB Entry: 1hlc (more details), 2.9 Å
SCOP Domain Sequences for d1hlcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlcb_ b.29.1.3 (B:) S-lectin, different isoforms {Human (Homo sapiens)} elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf nmssfklke
Timeline for d1hlcb_: