Lineage for d1hlcb_ (1hlc B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226891Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 226911Protein S-lectin, different isoforms [49933] (4 species)
  7. 226928Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 226940Domain d1hlcb_: 1hlc B: [24209]
    complexed with gal, glc

Details for d1hlcb_

PDB Entry: 1hlc (more details), 2.9 Å

PDB Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-ii, in complex with lactose at 2.9 angstroms resolution

SCOP Domain Sequences for d1hlcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlcb_ b.29.1.3 (B:) S-lectin, different isoforms {Human (Homo sapiens)}
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke

SCOP Domain Coordinates for d1hlcb_:

Click to download the PDB-style file with coordinates for d1hlcb_.
(The format of our PDB-style files is described here.)

Timeline for d1hlcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hlca_