![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (43 species) not a true protein |
![]() | Species West Nile virus [TaxId:11082] [255209] (2 PDB entries) |
![]() | Domain d2i69a2: 2i69 A:301-403 [242089] Other proteins in same PDB: d2i69a1 automated match to d3p54a2 |
PDB Entry: 2i69 (more details), 3.11 Å
SCOPe Domain Sequences for d2i69a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i69a2 b.1.18.0 (A:301-403) automated matches {West Nile virus [TaxId: 11082]} tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgss
Timeline for d2i69a2: