Lineage for d2i69a1 (2i69 A:1-300)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956252Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 1956253Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 1956296Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 1956297Protein automated matches [227047] (5 species)
    not a true protein
  7. 1956313Species West Nile virus [TaxId:11082] [255208] (2 PDB entries)
  8. 1956314Domain d2i69a1: 2i69 A:1-300 [242088]
    Other proteins in same PDB: d2i69a2
    automated match to d3p54a1

Details for d2i69a1

PDB Entry: 2i69 (more details), 3.11 Å

PDB Description: crystal structure of the west nile virus envelope glycoprotein
PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d2i69a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i69a1 f.10.1.0 (A:1-300) automated matches {West Nile virus [TaxId: 11082]}
fnclgmsnrdflegvsgatwvdlvlegdscvtimskdkptidvkmmnmeaanlaevrsyc
ylatvsdlstkaacptmgeahndkradpafvcrqgvvdrgwgngcglfgkgsidtcakfa
cstkaigrtilkenikyevaifvhgpttveshgnystqvgatqagrfsitpaapsytlkl
geygevtvdceprsgidtnayyvmtvgtktflvhrewfmdlnlpwssagstvwrnretlm
efeephatkqsvialgsqegalhqalagaipvefssntvkltsghlkcrvkmeklqlkgt

SCOPe Domain Coordinates for d2i69a1:

Click to download the PDB-style file with coordinates for d2i69a1.
(The format of our PDB-style files is described here.)

Timeline for d2i69a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i69a2