SCOPe 2.05: Domain d2i59a_: 2i59 A:

Lineage for d2i59a_ (2i59 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d2i59a_: 2i59 A: [242087]
   automated match to d2af0a_

Details for d2i59a_

PDB Entry: 2i59

PDB Description: solution structure of rgs10

PDB Compounds: (A:) Regulator of G-protein signaling 10

SCOPe Domain Sequences for d2i59a_:

Sequence; same for both SEQRES and ATOM records:

>d2i59a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqslkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmq
ekakeiymtflsskassqvnvegqsrlnekileephplmfqklqdqifnlmkydsysrfl
ksdlflkhkrteeeeedl

Timeline for d2i59a_:

• d2i59a_ first appeared in SCOPe 2.04
  
• d2i59a_ is called d2i59a1 in SCOPe 2.06
  
• d2i59a_ appears in the current release, SCOPe 2.08, called d2i59a1