SCOPe 2.07: Domain d2i3ea1: 2i3e A:5-222

Lineage for d2i3ea1 (2i3e A:5-222)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (6 species)
   not a true protein

7. Species Carassius auratus [TaxId:7957] [255230] (1 PDB entry)

8. Domain d2i3ea1: 2i3e A:5-222 [242084]
   Other proteins in same PDB: d2i3ea2
   automated match to d2ilxa1

Details for d2i3ea1

PDB Entry: 2i3e

PDB Description: solution structure of catalytic domain of goldfish rich protein

PDB Compounds: (A:) g-rich

SCOPe Domain Sequences for d2i3ea1:

Sequence; same for both SEQRES and ATOM records:

>d2i3ea1 d.61.1.0 (A:5-222) automated matches {Carassius auratus [TaxId: 7957]}
elplffgwfllpeeeerikcatmdflktldtleafkehiseftgeaekevdleqyfqnpl
qlhcttkfcdygkaegakeyaelqvvkesltksyelsvtalivtprtfgarvalteaqvk
lwpegadkegvapallpsvealpagsrahvtlgcsagvetvqtgldlleilalqkegkeg
tqvemdlgtltylsegrwflalrepinadttftsfsed

Timeline for d2i3ea1:

• d2i3ea1 first appeared in SCOPe 2.04, called d2i3ea_
  
• d2i3ea1 appears in SCOPe 2.06
  
• d2i3ea1 appears in the current release, SCOPe 2.08