SCOPe 2.04: Domain d2i3ea_: 2i3e A:

Lineage for d2i3ea_ (2i3e A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (4 species)
   not a true protein

7. Species Carassius auratus [TaxId:7957] [255230] (1 PDB entry)

8. Domain d2i3ea_: 2i3e A: [242084]
   automated match to d2ilxa1

Details for d2i3ea_

PDB Entry: 2i3e

PDB Description: solution structure of catalytic domain of goldfish rich protein

PDB Compounds: (A:) g-rich

SCOPe Domain Sequences for d2i3ea_:

Sequence; same for both SEQRES and ATOM records:

>d2i3ea_ d.61.1.0 (A:) automated matches {Carassius auratus [TaxId: 7957]}
gshmelplffgwfllpeeeerikcatmdflktldtleafkehiseftgeaekevdleqyf
qnplqlhcttkfcdygkaegakeyaelqvvkesltksyelsvtalivtprtfgarvalte
aqvklwpegadkegvapallpsvealpagsrahvtlgcsagvetvqtgldlleilalqke
gkegtqvemdlgtltylsegrwflalrepinadttftsfsed

Timeline for d2i3ea_:

• d2i3ea_ is new in SCOPe 2.04-stable
  
• d2i3ea_ appears in SCOPe 2.05
  
• d2i3ea_ appears in the current release, SCOPe 2.08, called d2i3ea1