Lineage for d2i3ea1 (2i3e A:5-222)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956626Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2956627Protein automated matches [190796] (6 species)
    not a true protein
  7. 2956628Species Carassius auratus [TaxId:7957] [255230] (1 PDB entry)
  8. 2956629Domain d2i3ea1: 2i3e A:5-222 [242084]
    Other proteins in same PDB: d2i3ea2
    automated match to d2ilxa1

Details for d2i3ea1

PDB Entry: 2i3e (more details)

PDB Description: solution structure of catalytic domain of goldfish rich protein
PDB Compounds: (A:) g-rich

SCOPe Domain Sequences for d2i3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i3ea1 d.61.1.0 (A:5-222) automated matches {Carassius auratus [TaxId: 7957]}
elplffgwfllpeeeerikcatmdflktldtleafkehiseftgeaekevdleqyfqnpl
qlhcttkfcdygkaegakeyaelqvvkesltksyelsvtalivtprtfgarvalteaqvk
lwpegadkegvapallpsvealpagsrahvtlgcsagvetvqtgldlleilalqkegkeg
tqvemdlgtltylsegrwflalrepinadttftsfsed

SCOPe Domain Coordinates for d2i3ea1:

Click to download the PDB-style file with coordinates for d2i3ea1.
(The format of our PDB-style files is described here.)

Timeline for d2i3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i3ea2