Lineage for d2i0na_ (2i0n A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1784067Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [255229] (1 PDB entry)
  8. 1784068Domain d2i0na_: 2i0n A: [242081]
    automated match to d3ulrb_

Details for d2i0na_

PDB Entry: 2i0n (more details)

PDB Description: structure of dictyostelium discoideum myosin vii sh3 domain with adjacent proline rich region
PDB Compounds: (A:) Class VII unconventional myosin

SCOPe Domain Sequences for d2i0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0na_ b.34.2.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
mgplgspefakyaralkdynvsdtsllpfkrndiititfkdqenkwfmgqlngkegsfpv
dhveillsdvpppqpvhpva

SCOPe Domain Coordinates for d2i0na_:

Click to download the PDB-style file with coordinates for d2i0na_.
(The format of our PDB-style files is described here.)

Timeline for d2i0na_: